PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g32470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 270aa    MW: 30677.2 Da    PI: 5.1877
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g32470genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.32.2e-18178211134
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                Cs+Cgt +Tp+WR gp g+ktLCnaCG+++++ +
  Tp7g32470 178 CSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGR 211
                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.6E-8313269IPR016679Transcription factor, GATA, plant
SMARTSM004011.5E-15172222IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-15175235No hitNo description
PROSITE profilePS5011411.952176208IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.5E-14176209IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.44E-15177234No hitNo description
PROSITE patternPS003440178203IPR000679Zinc finger, GATA-type
PfamPF003205.0E-16178212IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MELWTEARAL KARLRGEAIK HQVIVSEELS RTSSAEDFSV ECFLDFSEEG QEEEEEEEEL  60
VSVSSSQEEQ EQDCIFSSQP CIFDHLPSLP DEDVEELEWV SRVVDDCSTP EVSLLFTQTQ  120
KAKPSLSYRI PVKPRSKRSR NSLTGDRVWP LVSSNQHATG EQRRKKKQET GVVFQRRCSH  180
CGTNNTPQWR TGPVGPKTLC NACGVRFKSG RLCPEYRPAD SPTFSNEIHS NLHRKVLELR  240
KSKELGEETV EEATTKSDQV KFGSKVVEKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527710.0AK352771.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-P20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108712.11e-169PREDICTED: GATA transcription factor 3-like
RefseqXP_009108711.11e-169PREDICTED: GATA transcription factor 3-like
SwissprotQ8L4M61e-149GATA3_ARATH; GATA transcription factor 3
TrEMBLM4F0P91e-169M4F0P9_BRARP; Uncharacterized protein
STRINGBra034644.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57392647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-144GATA transcription factor 3